SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008706 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008706
Domain Number 1 Region: 34-277
Classification Level Classification E-value
Superfamily Caspase-like 2.54e-93
Family Caspase catalytic domain 0.00000000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008706   Gene: ENSBTAG00000006615   Transcript: ENSBTAT00000008706
Sequence length 277
Comment pep:known_by_projection chromosome:UMD3.1:26:34457100:34464840:1 gene:ENSBTAG00000006615 transcript:ENSBTAT00000008706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRHAFYASSKIKSKKKKNDSGKSVNIPRDRVPTYQYNMNFEKVGKCIIINNKNFDRITGM
GVRNGTDKDAEALFKCFRSLGFDVSVYNDCSCAKMQDLLKKASEEDHRNSACFACILLSH
GEENLIYGTDGKTAIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPIND
TDANPRYKIPVEADFLFAYSTVPGYYSWRNPGSGSWFVQALCSILNEHGKSLEILQILTR
VNDRVARHFESQSDDPRFHEKKQIPCVVSMLTKELYF
Download sequence
Identical sequences F1MD58
ENSBTAP00000008706 ENSBTAP00000008706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]