SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000008710 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000008710
Domain Number 1 Region: 210-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-67
Family Protein kinases, catalytic subunit 0.000000203
Further Details:      
 
Domain Number 2 Region: 93-228
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-30
Family SH2 domain 0.00000189
Further Details:      
 
Domain Number 3 Region: 27-116
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000958
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000008710   Gene: ENSBTAG00000006619   Transcript: ENSBTAT00000008710
Sequence length 483
Comment pep:known chromosome:UMD3.1:7:21421266:21429075:1 gene:ENSBTAG00000006619 transcript:ENSBTAT00000008710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSPRFLHAWHPSPISARMPTRRWAPGTQCITKCEHTRPKPGELAFCKGDVVTILEACENK
SWYRAKHHASGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDGLF
LVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEEVCFCNLMDMVEYYSKDQGAIC
TKLVRPKRKQGTKSAEEELAKGGDLLGKXHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNI
KCDVTAQAFLDETAVMTKVQHKNLVRLLGVILHQGLYIVMEHVSKGEVVGVGLGGCRALV
NTPQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSS
RLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRME
PPEGCPGSIHALMGSCWEAEPTRRPPFRKLAEKLARELRSVGASAPNGGQDTDGPAPPRS
QEP
Download sequence
Identical sequences F1MD57
ENSBTAP00000008710 ENSBTAP00000008710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]