SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009070 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009070
Domain Number 1 Region: 1265-1407
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000122
Further Details:      
 
Domain Number 2 Region: 297-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.01e-36
Family PLC-like (P variant) 0.0035
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-26
Family Dual specificity phosphatase-like 0.00024
Further Details:      
 
Domain Number 4 Region: 1111-1259
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 23-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000523
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009070   Gene: ENSBTAG00000006904   Transcript: ENSBTAT00000009070
Sequence length 1409
Comment pep:known_by_projection chromosome:UMD3.1:5:27069113:27082523:-1 gene:ENSBTAG00000006904 transcript:ENSBTAT00000009070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRATSRPRKAEPHSFREKVFRKKPPVCAVCKAAIDGTGVSC
RVCKVATHRKCEAKVTSSCQALPPVELRRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAASFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGSKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVAAELQPSQRRYITYFSGLLSGSIRMNSS
PLFLHHVLVPVLPAFEPGAGFQPFLKIYQSMQLVYTSGIYHIAGPGPQQLCISLEPALLL
KGDVMVTCYHKGSRGTDRTLVFRVQFHTCTIHGPRLTFSKDQLDEAWTDERFPFQASVEF
VFSSSPEKIKGNTPQNEPSVSVDYNTAEPAVRWDSYENFNLHHEDSADDSVTHTRGPLDG
SPYAQVQRAPRQTPPAPSPEPPPPPLLSVSSDSGHSSTLTTEPAAESPGRPPPTAAERQE
LERLLGGCGVASGGRGAGRETAILDDEDQPAAGGGPHLGIYSGHRPGLSRHCSCRQGYRE
PCGVPNGGYYRPEGTLERRRLAFGAYEGPPQGYAEPSVEKRRLCRSLSEGPYPYPSELGK
PANGDFGYRPPGYREVVILEDPGLPPLCSCPACEEKLALPTAALYGLRLEREAGEGWASE
AGKPLLHPVRPGHPLPLLVPACGHHHTPLPDYSCLKPPKAGEEGHEGCSYALCPEGRYGH
PGYPALVTYGYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPRAHSPRAGSISPGSPPYPQ
SRKLSYEIPAEEGGDRYLLPGHLAPAGPLASAESPEPVSWREGPSGHSTLPRSPRDAQCS
AASELSGPSTPLHTSSPVQGKESARRQDTRSPTLAPTQRLSPAEALPPVSQGGADKAPEL
PARSGPEPPAPGAFSLASPPSSPNDWPQERSPGGRSDSASPRGPVPNTLPGLRHAPWQGL
RDPPDSPDGSPLTPVPTQMPWLVASPEPPQSSPTPAFPLAASYDINGAPQPPLPEKRHLL
GPGQQPGPWGPEQASPPARGASHHVTFAPLLPDNTPQPPEPPMQESQSNVKFVQDTSKFW
YKPHLSRDQAITLLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQSWKGDPSEQLVR
HFLIETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEEVPEAPVP
SNMSTAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSA
QGITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNSDGTTSKIFGFVAKKPGSPWENV
CHLFAELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences E1BGX7
XP_001790253.1.59421 XP_002687289.1.76553 ENSBTAP00000009070 9913.ENSBTAP00000009070 ENSBTAP00000009070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]