SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009107 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009107
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 7.72e-25
Family Ribosomal protein S18 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009107   Gene: ENSBTAG00000006936   Transcript: ENSBTAT00000009107
Sequence length 258
Comment pep:known_by_projection chromosome:UMD3.1:23:28169926:28176489:-1 gene:ENSBTAG00000006936 transcript:ENSBTAT00000009107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNVLLRRLPYFSPFRGAYGVQVPLQTLCTKAPPEDDSLPPIPVSPYEDEPWKYLD
SEEYHNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNV
KLLKQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGHLREESGPPPESMPKVPL
TAPTEATSTEQAGPQSAL
Download sequence
Identical sequences F1N059 L8HWA3
ENSBTAP00000009107 ENSBTAP00000009107 9913.ENSBTAP00000009107 9913.ENSBTAP00000035758 XP_005907004.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]