SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009115 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009115
Domain Number 1 Region: 42-114
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000014
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009115   Gene: ENSBTAG00000006943   Transcript: ENSBTAT00000009115
Sequence length 438
Comment pep:known_by_projection chromosome:UMD3.1:19:47474735:47507698:1 gene:ENSBTAG00000006943 transcript:ENSBTAT00000009115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSEIKAKFKLNPLTKVPNFHSRRDKDLPGLLPCQLQHKERKLSPSQMRAFQDAYNFFN
KDKTGCIDLHGMMCTLAKLGMNLTKHDVHNELRCADIDQDGKVNFSDFLKVLTDKNRFLK
AVVPEKGTCLDLAGNPGILLFEILSKLIETSALPKKAISEIVSYFRRKFQETTSGMVWSP
DTTGYGKRRFKPDICTPPSSSTAAFANAARIAIMKEKDLFKFLDELKKCNPPSDSPYSKI
PIFPLFPNVDGVVMGKPFKDIQKLEMLKRKEPLNFFENYFFHKKDWKTQAANIKPVDPTS
GYSTDILTIDQMLKRKQNWTVADAAAIKPHVKRATETYNLGIALEHRKQMLNLWRKIRGD
LIGIESKNESFYDTFSTYTWSWNVCQELLSPKDLKLYDAHVNRNALHNSVFSSSSDISEC
DTDTGRKRKRKGFKGFRQ
Download sequence
Identical sequences F1N057
ENSBTAP00000009115 9913.ENSBTAP00000009115 ENSBTAP00000009115 XP_019836294.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]