SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009363 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009363
Domain Number 1 Region: 306-419
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.06e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000605
Further Details:      
 
Domain Number 2 Region: 51-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009363   Gene: ENSBTAG00000007115   Transcript: ENSBTAT00000009363
Sequence length 420
Comment pep:known chromosome:UMD3.1:27:25943820:25973543:-1 gene:ENSBTAG00000007115 transcript:ENSBTAT00000009363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCESKFNWRIIKEKRDAYVSRLNTIYQNNL
TKSHIDIIHGHAAFTCDPQPTVEVNGKKYTAPHILIATGGVPSVPQESQIPGASLGITSD
GFFQLEELPRRSVIVGAGYIAVEIAGILSALGSKTSIMIRHDKVLRTFDSIISSNCTEEL
ENAGIEVLKYSQVREVKKTSSGLELRMVTSIPGREPTFTTIADVDCLLWAIGRDPNSWGL
NLNKLGIQTDDKGHIIVDEFQNTNVKGVYAVGDVCGKALLTPVAIAAGRKLAHRLFECKE
DSKLDYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTTFTPMYHAVTKRKTKCV
MKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKSDFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences E1BKZ1
ENSBTAP00000009363 ENSBTAP00000009363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]