SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009406 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009406
Domain Number 1 Region: 346-621
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.89e-87
Family Eukaryotic proteases 0.000000000955
Further Details:      
 
Domain Number 2 Region: 104-194
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-32
Family Kringle modules 0.00000354
Further Details:      
 
Domain Number 3 Region: 210-298
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-29
Family Kringle modules 0.00000395
Further Details:      
 
Domain Number 4 Region: 45-106
Classification Level Classification E-value
Superfamily GLA-domain 8.41e-18
Family GLA-domain 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009406   Gene: ENSBTAG00000007148   Transcript: ENSBTAT00000009406
Sequence length 625
Comment pep:known chromosome:UMD3.1:15:77530565:77544935:1 gene:ENSBTAG00000007148 transcript:ENSBTAT00000009406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERE
CLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGN
VSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRRE
ECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTSGSRCLAWSS
EQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDL
GDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFE
SYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNF
TVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDY
IHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCK
ASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRD
GKYGFYTHVFRLKKWIQKVIDRLGS
Download sequence
Identical sequences P00735
ENSBTAP00000009406 9913.ENSBTAP00000009406 XP_015330343.1.76553 ENSBTAP00000009406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]