SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009469 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009469
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.2e-43
Family Calponin-homology domain, CH-domain 0.000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009469   Gene: ENSBTAG00000007196   Transcript: ENSBTAT00000009469
Sequence length 201
Comment pep:known chromosome:UMD3.1:15:28318411:28323666:1 gene:ENSBTAG00000007196 transcript:ENSBTAT00000009469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVMQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVTKTDMFQTVDLFEG
KDLAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences Q9TS87 V6F957
ENSBTAP00000009469 9913.ENSBTAP00000009469 ENSBTAP00000009469 NP_001039614.1.59421 NP_001039614.1.76553 XP_005215887.1.76553 XP_005897247.1.15283 XP_006080905.1.26621 XP_010828693.1.44457 XP_014334142.1.15283 XP_019830548.1.53367 XP_019830549.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]