SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009568 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009568
Domain Number 1 Region: 26-116
Classification Level Classification E-value
Superfamily Immunoglobulin 6.24e-16
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009568   Gene: ENSBTAG00000007275   Transcript: ENSBTAT00000009568
Sequence length 230
Comment pep:known chromosome:UMD3.1:23:15090107:15094736:-1 gene:ENSBTAG00000007275 transcript:ENSBTAT00000009568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVVLLILLAVTELSRAHNTTVFQGMMGRSLRVSCPYNSLKHWGRRKAWCRQLGEEGLC
QQVVSTHPSWLLSFLKRRNGSTAITDDALGGTLTITLRNLQTHDAGLYQCQSLHGSEADT
LRKVLVEVLADPRDYQDPGDLWIPEGSESFENAQVEHSISRSLSEEESPFPPTSILFLLA
CIFLSKLLAASALWAAAWHGQKQRPPQASGPDCGHNPGYQLQTLTELRDV
Download sequence
Identical sequences Q05B59
9913.ENSBTAP00000009568 ENSBTAP00000009568 ENSBTAP00000009568 NP_001073048.1.59421 NP_001073048.1.76553 XP_010861500.1.44457 XP_019840955.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]