SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009636 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009636
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.92e-87
Family Eukaryotic proteases 0.0000000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009636   Gene: ENSBTAG00000016520   Transcript: ENSBTAT00000009636
Sequence length 271
Comment pep:known chromosome:UMD3.1:25:987390:989247:-1 gene:ENSBTAG00000016520 transcript:ENSBTAT00000009636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALALLLSLVSAAPGQALQRAGIVGGQEAPGSRWPWQVSLRVSRRYWRHHCGGSLI
HPQWVLTAAHCVGPEVHGPSYFRVQLREQHLYYQDQLLPISRIIPHPNYYSVKNGADIAL
LELDKLVNISWHVQPVTLPPESETFPPGTQCWVTGWGNVDNGRRLPPPFPLKQVKVPVVE
NSVCDRKYHSGLSTGDNVPIVREDMLCAGDSGRNFCQGDSGGPLVCKVNGTWLQAGVVSW
GDGCAKPNRPGIYTRVTSYLDWIHQYVPQGP
Download sequence
Identical sequences A6QPI9
XP_003584043.2.59421 XP_003587843.1.76553 ENSBTAP00000009636 ENSBTAP00000009636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]