SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009746 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009746
Domain Number 1 Region: 151-432
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.17e-80
Family Eukaryotic proteases 0.000000245
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 9.62e-24
Family GLA-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009746   Gene: ENSBTAG00000007411   Transcript: ENSBTAT00000009746
Sequence length 447
Comment pep:known chromosome:UMD3.1:12:90508105:90514384:1 gene:ENSBTAG00000007411 transcript:ENSBTAT00000009746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQAWALALLCFLLSLWGSLPAVFLPQEQALSILHRPRRANGFLEELLPGSLERECREE
LCSFEEAHEIFRNEERTRQFWVSYNDGDQCASSPCQNGGSCEDQLRSYICFCPDGFEGRN
CETDKQSQLICANDNGGCEQYCGADPGAGRFCWCHEGYALQADGVSCAPTVEYPCGKIPV
LEKRNGSKPQGRIVGGHVCPKGECPWQAMLKLNGALLCGGTLVGPAWVVSAAHCFERLRS
RGNLTAVLGEHDLSRVEGPEQERRVAQIIVPKQYVPGQTDHDVALLQLAQPVALGDHVAP
LCLPDPDFADQTLAFVRFSAVSGWGQLLERGVTARKLMVVLVPRLLTQDCLQQSRQRPGG
PVVTDNMFCAGYSDGSKDACKGDSGGPHATRFRGTWFLTGVVSWGEGCAAAGHFGIYTRV
SRYTAWLRQLMGHPPSRQGFFQVPLLP
Download sequence
Identical sequences P22457
ENSBTAP00000009746 9913.ENSBTAP00000009746 9913.ENSBTAP00000046678 NP_001029978.1.59421 NP_001029978.1.76553 ENSBTAP00000009746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]