SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009800 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009800
Domain Number 1 Region: 474-755
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.88e-60
Family Eukaryotic proteases 0.00000000108
Further Details:      
 
Domain Number 2 Region: 202-471
Classification Level Classification E-value
Superfamily vWA-like 1.29e-55
Family Integrin A (or I) domain 0.0000000228
Further Details:      
 
Domain Number 3 Region: 164-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.0000429
Further Details:      
 
Domain Number 4 Region: 97-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000111
Family Complement control module/SCR domain 0.000036
Further Details:      
 
Domain Number 5 Region: 44-84
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000292
Family Complement control module/SCR domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009800   Gene: ENSBTAG00000046158   Transcript: ENSBTAT00000009800
Sequence length 761
Comment pep:known chromosome:UMD3.1:23:27225270:27231292:-1 gene:ENSBTAG00000046158 transcript:ENSBTAT00000009800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIGHNPRLCLVPLILGLLCGGVGMTPLPEAGPQSPCSLEGVEIKGGSFRLLKAGQVLEY
LCPSGFYPYPTQIRTCRSTGSWSTLQTQDRKIVKRAECKAIRCPRPQDFENGEYWPRAAY
YNLSDEISFRCYDGYTLRGSANRTCQGNGRWDGETAICDDGATYCPNPGIPLGTRKVGSQ
YRLEDRVTYYCNRGLTLRGSEQRTCLEGGSWSGTEPSCQDSFMYDTPAEVAEAFLSSLTE
TIEGVDAEDGHSPGEQQKRKIVLDPSGSMNIYLVLDGSDSVGAHNFTGAKNCLRDFIEKV
ASYGVKPKYGLVTYATEPKVLIRVSDPKSSEADWVTDQLNQINYADHKLKAGTNTKRALL
EVYNMMSREVNQFKETWNRTRHVIIIMTDGLHNMGGDPVTVIHDIRYLLDIGRNRKNPRE
DYLDIYVFGVGPLVNQENINALASKKDKEKHVFKLQGMENLEDVFVQMLDESRTLGLCGM
VWEHKDGTAYHKQPWQAKISVTRPSKGHESCMGAIVSEYFVLTAAHCFTVDDEKHSIKVS
LGGQRKEWEVKEILFHPKYDLNAKKAKGIPEFYDYDVALVRLKEKLKYETTIRPICLPCT
EGSIQALRLPRSTTCQQQMQELLPAKDIEALFVSESKKTLTRKAVYIKNGDKKASCERDA
LRAPGYEKVKDVSEVVTPRFLCTGGVDPYADPNTCKGDSGGPLIIHKRSRFIQVGVISWG
VVDVCKRPQQVPGYARDFHINLYQVLPWLKEKLQNEDLGFL
Download sequence
Identical sequences P81187
ENSBTAP00000009800 ENSBTAP00000009800 NP_001035616.1.59421 NP_001035616.1.76553 XP_019841138.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]