SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009822 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009822
Domain Number 1 Region: 434-779
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.64e-61
Family Ankyrin repeat 0.000029
Further Details:      
 
Domain Number 2 Region: 145-220
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.14e-23
Family Mib/herc2 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 63-137
Classification Level Classification E-value
Superfamily RING/U-box 2.94e-21
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 4 Region: 11-73
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 6.67e-20
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 5 Region: 944-1004
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000442
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000009822
Domain Number - Region: 815-859
Classification Level Classification E-value
Superfamily RING/U-box 0.00232
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Domain Number - Region: 862-907
Classification Level Classification E-value
Superfamily RING/U-box 0.018
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009822   Gene: ENSBTAG00000007467   Transcript: ENSBTAT00000009822
Sequence length 1006
Comment pep:known chromosome:UMD3.1:24:34812337:34901981:-1 gene:ENSBTAG00000007467 transcript:ENSBTAT00000009822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
GNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
KLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNK
GHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNAL
HHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLD
IQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQD
MQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLC
PDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
SLCSPRVKKCLLCKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCASLMKKCVQC
RAVVERRVPFIMCCGGKSAEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ
TMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Download sequence
Identical sequences E1BJ09
9913.ENSBTAP00000009822 ENSBTAP00000009822 ENSBTAP00000009822 NP_001192959.1.59421 NP_001192959.1.76553 XP_006079252.1.26621 XP_012006781.1.54773 XP_017895009.1.57651 XP_019842113.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]