SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009897 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009897
Domain Number 1 Region: 43-172
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 242-302
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.19e-19
Family EB1 dimerisation domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009897   Gene: ENSBTAG00000007520   Transcript: ENSBTAT00000009897
Sequence length 326
Comment pep:known chromosome:UMD3.1:24:22193149:22306884:-1 gene:ENSBTAG00000007520 transcript:ENSBTAT00000009897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPP
PDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASRSDKDLE
TQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDVLYASD
EHEGHPEEPEAEEQVHEQQPQQQEEY
Download sequence
Identical sequences L8IWV3 Q3SZP2
ENSBTAP00000009897 9913.ENSBTAP00000009897 ENSBTAP00000009897 NP_001029546.1.59421 NP_001029546.1.76553 XP_005889296.1.15283 XP_010848064.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]