SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000009967 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000009967
Domain Number 1 Region: 560-601,686-738,773-792,824-874
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000258
Family Nucleotide and nucleoside kinases 0.01
Further Details:      
 
Domain Number 2 Region: 1465-1591
Classification Level Classification E-value
Superfamily EF-hand 0.00000124
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000009967   Gene: ENSBTAG00000023529   Transcript: ENSBTAT00000009967
Sequence length 1824
Comment pep:known_by_projection chromosome:UMD3.1:20:38404694:38606719:-1 gene:ENSBTAG00000023529 transcript:ENSBTAT00000009967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEILCQWLNQELKVSQTVSPKSFAKAFSSGYLIGEVLHKFALQDDFADFSESRISSAKL
NNFSRLEPTLHLLGVQFDQNVAHNIITEKPGAATKLLYQLYIALQRKKKGVQTGVEMPTV
QPLMSTKVQNMKSEAFRDSHPRHMSQIEFFLSMIRQVMKVELVSPPIMKIDTFHLHNLGT
PKLCFNIILFKQRLSRRRQNEIMAKIQAAIIQIPKPTSNRTLKTLDAQKLMKKKKEAEDV
ANEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDDYIKKIQKRLEEDAFAR
EQREKRRRRLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQ
NRIFREKQYEERRLKDFQDALDREAALARQAKIDFEEQALRDKEIHEQIAIERAQARYEK
HYSICAEILDQILDLSTKVADYRLLTNNLIPYKLMHDWKELFFHGKPIYEQASLRHLPTK
LSAEHLIELEKRNLLDNNDYEEYKNMVGEWALPEEMVENLPPSNNCILGHVIHRLIESSL
PPQVESTVPELPSFAIKGCLLGKTFSGKTTALKALEKSFPIQVLSIDTLVQEAIQAFHDK
ESVSGAHGLQKAPEEKALPVRQESDEDNQACTSSPKDVQDGSLAEALPKKEDKTRLDTDA
RKAAKAEEVVASDSFSELTVRAQLGAKSERLLKKGKSISDILLVSIMVNAINQIPMYKGW
ILDGFPMTLNQAKLLEEALTGYNRNLIELEGKKSHTSTLAVDPTASKEVPLPPSAFDFVM
LLDISDNSSLNRMNDIMAEAFSSETPLEDINQRVAAKNKDTDEDQNLRDQIQHRIVGFLD
NWPSLEQWFTEPENILIKINAEVDKQSLCQKVKEMFMTEIMKKENKVKKKLEEKEAERKE
EVSLTEKTSPPPPPPPPPEPEKEKEVHLPQERSKTPAAKGKQASEPPHGNREPLQEGKGK
KSETSLKRKGSPRGKSLGGKIPLKKSPAESTDVSPVPVVPAPSKPGSEEWVYVNEPIPEE
IPSFLVPYWKLIENSYINSIKTVLRQLREDQHAVLAYLYDIRTGFQQFLRRPDHKQDFVS
QWQADFNSLPDDLWDDEETKAELHQRVNDFRDRLWDICDARKEEAEQERLDIINESWLQD
STGIAMNHFFSLMQAELNRFQDTKRLLQDYYRAMECKIPMDDTKRFTRVPLVQLDSKDIL
ESQLRIPLVPRRSISPESALSKPKTKSILKGKIDYMLESVELNFEADEKMVMDTWQQSSL
AISHMVAAEIHQRLMEEEKENQPAETKEKLPQAAANKKVKKEPPPPPPPPKKKKEDKKGK
GKSPPMTEAAPVVLPAEETEEVEVKNELKLRIKEEHLAALQFEEIATQFRLELIKVKALA
FLEELVIKAVDVYRLMEKWLGERYLNEMASVEKLTGVARYHIETSTKIQNELYLDQEDFF
INGDIKVFPDPPPPVRPPPVEKEENGTLTIEQLDNLRDQFLDIAPKGIIGNKAFADLLLD
LVTLNLGTNNFPSSWMNLTQPELQELASLLVTNSESVDWRKFLLVVALPWPIPLEEELLE
TLQRFKALDAEQLGTITYEQYKQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLF
ADCEKDPPQLDYTQMLLYFACHPDSTEGVYRALSVAIGTHVFQPIEMPHPVAEKTSSFTD
MSPIEEYPELEDNFMSEERELQEDGEEKEEEIPENANTEMISMQTLLQVFRGGNEVLDAN
RFASHQKLENTYLENFIKVFQDLGSKNLEPIEVAVLLKHPFIQDLISSYPDYKIPDVKII
LQRSEHVQGSDEERSPSRLTEEKK
Download sequence
Identical sequences F1MUD3
ENSBTAP00000009967 ENSBTAP00000009967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]