SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010065 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000010065
Domain Number - Region: 274-306
Classification Level Classification E-value
Superfamily Kringle-like 0.0864
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010065   Gene: ENSBTAG00000007650   Transcript: ENSBTAT00000010065
Sequence length 463
Comment pep:known chromosome:UMD3.1:2:31391774:31446946:1 gene:ENSBTAG00000007650 transcript:ENSBTAT00000010065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYPGQRPVIPPQSHRDDRETLVSEHKHKGKTCRQSAAVFNVVNSIIGSGIIGLPYSMKQ
AGFPLGILLLFWVSYVTDFSLILLIKGAALSGTDTYQSLVNRTFGFPGYLLLSVLQFLYP
FIAMISYNIITGDTLSKVFQRIPGVDPENLLIGRHLIIVLSTVVFTLPLSLYRDIAKLGK
ISLISTVLTTLILGIVVARGVSLGPHIPKTEDAWIFAKPNAVQAVGVMSFAFICHHNCFL
VYGSLEEPTVAKWSHIIHVSTLISVFISILFATCGYLTFTGYTQGDLFENYCRNDDLVTF
GRFCYGVTVILTYPIECFVTREVIANVFFGGNLSSVCHIIVTVVIITVATLVSLLIDCLG
IVLELNGVLCAAPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMAVGFVMAVTS
PQDCSHGQEMFYCSPDNFSLTNISISHLQLTTQLSILNVSIFQ
Download sequence
Identical sequences F1MMH7
9913.ENSBTAP00000010065 ENSBTAP00000010065 ENSBTAP00000010065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]