SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010204 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010204
Domain Number 1 Region: 398-699
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.79e-103
Family PDEase 0.000000587
Further Details:      
 
Domain Number 2 Region: 184-375
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-48
Family GAF domain 0.00003
Further Details:      
 
Domain Number 3 Region: 27-176
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-20
Family GAF domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010204   Gene: ENSBTAG00000007758   Transcript: ENSBTAT00000010204
Sequence length 721
Comment pep:known_by_projection chromosome:UMD3.1:9:101987619:102068801:-1 gene:ENSBTAG00000007758 transcript:ENSBTAT00000010204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGECNNS
LCVFIPPGIKEGKPKLIPAGPIAQGTTTSAYVAKSRKTLLVEDILGDERFPRGTGLESGT
RIQSVLCLPIVTAIGDLIGILELYRHWGKEAFRLSHQEVATANLAWASVAIHQVQVCRGL
AKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDL
FDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYT
TRNILCMPIVSRGSVIGVVQMVNKLSGSAFSKTDENNFKMFAVFCALALHCANMYHRIRH
SECIYRVTMEKLSYHSICTAEEWQGLMHFNLPGRLCKEIELFHFDVGPFENMWPGIFVYM
IHRSCGTACFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNSRGLFTDLER
KGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFST
LSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTAC
DLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAV
AIPCYTTLTQIFPATEPLLKACRNNLSQWEKVIRGEESALGIPDLPEAEGSPERLPVKTD
D
Download sequence
Identical sequences F1MPW5
ENSBTAP00000010204 ENSBTAP00000010204 9913.ENSBTAP00000010204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]