SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010298 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010298
Domain Number 1 Region: 82-182
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-31
Family SH2 domain 0.000075
Further Details:      
 
Domain Number 2 Region: 27-78
Classification Level Classification E-value
Superfamily SH3-domain 0.00000125
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010298   Gene: ENSBTAG00000007828   Transcript: ENSBTAT00000010298
Sequence length 276
Comment pep:known chromosome:UMD3.1:14:9334778:9371281:1 gene:ENSBTAG00000007828 transcript:ENSBTAT00000010298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSMRSTPAPPERPLPSSEELDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWK
AISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKIGSFMIRESETKKGFY
SLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQTA
AAPAVRDSDSPVTLRQKTFDWRRAIRQQEDSEGAESPIAVDESLFSYGLRESIASYLSLT
GDDSTSFDRKKKSVSLMYSGSKRKSSFFSSPPYFED
Download sequence
Identical sequences Q0VCV4
ENSBTAP00000010298 NP_001019704.2.59421 NP_001019704.2.76553 XP_019829568.1.53367 ENSBTAP00000010298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]