SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010340 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010340
Domain Number 1 Region: 767-1069,1109-1163,1207-1262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.73e-70
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 2886-2969
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000177
Family Motor proteins 0.042
Further Details:      
 
Domain Number 3 Region: 1779-1849
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000147
Family Motor proteins 0.025
Further Details:      
 
Domain Number 4 Region: 1610-1706
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000265
Family Motor proteins 0.028
Further Details:      
 
Domain Number 5 Region: 1852-1927
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000319
Family Motor proteins 0.047
Further Details:      
 
Domain Number 6 Region: 2359-2440
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000797
Family Motor proteins 0.028
Further Details:      
 
Domain Number 7 Region: 1707-1775
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000504
Family Motor proteins 0.046
Further Details:      
 
Domain Number 8 Region: 2652-2719
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000531
Family Motor proteins 0.026
Further Details:      
 
Domain Number 9 Region: 2003-2065
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000531
Family Motor proteins 0.051
Further Details:      
 
Domain Number 10 Region: 1925-2002
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000558
Family Motor proteins 0.073
Further Details:      
 
Domain Number 11 Region: 1517-1614
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000956
Family Extended AAA-ATPase domain 0.09
Further Details:      
 
Domain Number 12 Region: 3241-3364
Classification Level Classification E-value
Superfamily ARM repeat 0.00000238
Family Armadillo repeat 0.038
Further Details:      
 
Domain Number 13 Region: 1259-1378
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000292
Family Motor proteins 0.054
Further Details:      
 
Domain Number 14 Region: 2773-2871
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000165
Family Motor proteins 0.028
Further Details:      
 
Domain Number 15 Region: 2214-2327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000177
Family Motor proteins 0.038
Further Details:      
 
Domain Number 16 Region: 2439-2512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000345
Family Motor proteins 0.054
Further Details:      
 
Domain Number 17 Region: 2056-2142
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000743
Family Motor proteins 0.035
Further Details:      
 
Domain Number 18 Region: 2512-2575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000743
Family Motor proteins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010340   Gene: ENSBTAG00000007860   Transcript: ENSBTAT00000010340
Sequence length 3461
Comment pep:known_by_projection chromosome:UMD3.1:16:77923530:77988157:-1 gene:ENSBTAG00000007860 transcript:ENSBTAT00000010340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATWQRGSGCWERSPPEPRPRAGPRGPRAEEEAASPAVLSLSHFCRSPFLCFGDVRLGAS
RTLPLILDNPNEEAAAVWLSRGPAAERGFTIWPSAFVLQPKEKIVVSITWTPLKGGRIRE
TITFLVNDILKHQAILLGNAEEPKKKKRTLWDTINKKKASASSRHNKKASNIQNVNKTFN
VSPKADRVRSPLQACENLATNGNCSPPESNPLILEENKLPISPISPASQECHRGTCLPLP
VRRSTTYTSLPASENGGLVKADGANTAEDFHFNEKGITETSFDSIDNVNSQIEENGKLTL
TPNYSSSLNITQSQGHFLSPDSFVNNSHASNNEPEFVKCLSPDMFVKGNTRPVILESKRV
HEICRKILSPDSFINDNYGLNEDLETESINPILSPNQFLKDNMAYICVSQQTCQLPLSTG
HFQDSQPPQDERKNAAVPCISECQQLESPKATFEASKALEVMSNSYTFKKQNQPKFSAVQ
DISSHSRKKPIKRRPILSATVTKRKPTCAVENQMETVKPKAKRCLNVVVGDCKKETDDQK
EKDDFHPFLPIRDLIQSRPKSSKNIVTPPCKVASVARKRKSEGHTGDENVRITVTECMEA
QEVKRPHFSPVESKTSTVKHTKKVVTSSLKRVSHREKLNLKKKTDSLGYRTPKTNRRTRP
FVPVAQSNLTFIKPLKGIPRHPMPFAAKNMFYDERWKEKQEQGFTWWLNFILTPDDFTVK
TNISEVNASTLLLGVESQHKVSVPKAPTKDEVSLRAYTARCRLNRLRRAACRLFTSEKMV
KAMKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETIYGELVPLE
DNSDVTGLAMFILNRLLWNPDIAAEYRHPSVPHLYRDGHEEALSKFTLKKLLLLICFLDY
AKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLGGEGDLSRHLSLLGFPVTHVQMPFD
EFDFAVKNLAVDLQCGVRLVRTMELLTQNWNLSKKLRIPAISRLQKMHNVDIVLEILKSR
GIQLNDEHGNAILSKDIVDRHREKTLALLWKIALAFQVDISLNLDQLKEEIDFLKNTQST
KKTMSALPCRPDAVISKKRDERHSGPFEQCSESVKLLMDWVNAVCGFYNKKVENFTVSFS
DGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTHTGSVVLNSSSESDGSFLDFSLKPPDQ
ENTSELYKELLENEKKNFQLVRSAARDLGGIPAMIHHSDMSNTIPDEKVVITYLSFLCAR
LLDLRKETRAARLIQTTWRQYKLKKDLKHHQKRDKAARIIQSAIINFLTKQRFKKKVSAA
LVIQKYWRRALAKRKLLMLKKEKLERVHSKSASIIQRHWRRYSTRKRFLKLKYYSIFLQS
KIRMIIAVASYKRYHWATVTIQRRWRAHVRSKQDRQRYELLRSSTLVIQFAFRRWRRRKR
QSQINAAITLQRAFRQWHVRKCAQEERAAVVIQSWYRMHRELRKYIHLRSCVIIIQARFR
CFQAQKLYTRTRESILTLQKHYRAYVKGKVERTGYLHKRAAAIRLQAAFRGRRARNLCRQ
IKAACVLQSYWRMRQDRLRFLNLKKNIIRLQAHIRRRQQLHTYQKMKKAALIIQIHFRAY
MSAKEVLASYQKTRSAVIVLQSACRRMQARKKFLHILTSIVKIQSYYRAYASRRKFLRLK
KATVKLQSIVRMKLARKQYLHLRAIAQQREEHRRASCIKLQAFLRGYLVRKQVRLQRKAA
VSLQSYFRMRKMRLDYLKVCHASVVIQRYYRAHRAGAQQRKHFLQVRRAVTCLQATYRGY
KVRRQLQQQSSAALKIQAAFRGYRQRTKYQSVLQSAFKIQRWYRTHKTVSAIRSHFFKTR
TAAISLQSAYRGWKVRKQMRKEHEAAVKIQSAFRTARAQKEFRMLKTAASVIQQHLRARA
AGRRQRTEYMALRRAAVMLQSAWRGRAARRRIQKQQRCAIIIQAYYRRHVQRKRWEIMKK
AAHLIQMHYRAYRTGRKQHHLFLKTKAAAIILQSAFRGVRVRKKVKEMHQAAATIQSRYR
AYQARKKYATYRAAAVIIQRWYRAAKLAGRQREEYLAVKKAALKIQAVYRGVRARRQIRR
MHTAATLIKATFKMQQSRRRYQQMRTAAIIIQVRYRAYRQGRAQRAKYLTILKAVALLQA
ALRGARVRQSLRRMRMAATLIQAHYRGRRQQAYFNKLKKVTKTVQQKYRAARERHAQLRR
YNQLRRSAICIQAAFRGMRARRRLKAMHSAAAVIQRRFRTLGMRRRFLSLRKTAVWVQRK
YRAKVCTRHHVQQLRLQKAAIKIQSWYRGWMVRKKIQETRRAATVLQAAFRRHRTRARYQ
AWRCASQVIQQRFRAGRAARLQRREYLQQRHSALVLQAAFRGMRVRRRLKRMHVSATLIQ
SRFRSIMRRKRFLSLKKAAVFVQRKYRATICAKHHLHRFLELQKAIIIIQASYRRRMVKK
QLQEMHRAAALIQASFRMHRARLAFQTWKHAAVLIQQRYRACRAAKLQRALYIRWRHSAV
VIQAAYKGLKARQLLREKHRAAVIIQSTYRMYRQHFFYQKLQWATKVIQERYRASKRKAL
QHDALKAATCARAGFQDMVVRRLIEERRHQAAITIQEHFRAFKTRKHYLHFRAKVVFVQR
RYRELMAVRTQAVICIQSCFRGFKARRGIQRMHLAATRIQSCYRRHRARADYQAKKRAVV
VIQNHYRSYIRVKMERKEFLAIQKSAPTIQAAFRGMKVRQKLKTMPDKKMAAPATQPAFY
CHRTESQHEAGHSPALVAQGLYKTSLVGPSQETEQHSQRKAAVTIQKAFHKMVTRRLEKQ
RRAAVRIQSFLQMAVYRRRFLQQKRAALTLQRCFRIQQSRKQFLLYREAAVGLQNPHRAS
LPAKHQRELYLQIRSSVIIIQARVKGFIQKRKFRELKDSTIKIQAVWRRHKARKYLREVK
AACRIQAWYRCWKARREYLAVLRAVRIIQRCFCTQQQRRRFLNVRASAVIIQRRWRTVLS
GRTTHEQSLMTKRHQAACLIQANFRGYKARQAFLQQKSAALTIQRYIRARKAGKHQRMKY
VELKKSTVVLQALVRGWLVRKRISEQRAKIRLLHFAAAAFYHLSALRIQRAYRRHVALKH
ANNKQLNSAICIQRWFRARSQRKRFLQKYSIINIQREAQEQARQHSRAASVIQRAVRRFL
LHKKQENFNKRIAKIQALWRGYSWRKKNDSTKTKAIRQRLQCVNREIREESKLYHRTAVA
LHHLLTYKYLSTVLEALKHLEAVTRLSSICCEKMAQSGAISKIFVLIRSCNRSVPCMEVI
RYAMQVLLNVAKYEKTTSAIYDVENCVDTLLELMQMYQEKSGDKVADKSRSIFTKTCCLL
AVLLKTTTRALDVQSRSKVVDRIYSLYKLTAHKHKVNTERILCKQKKNSSVSLSFFPETP
VRTTMVSRLKPDWVLRRDNVEEVMTPLQAIQMVLDTLSLPY
Download sequence
Identical sequences F1MM80
ENSBTAP00000010340 ENSBTAP00000010340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]