SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010351 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010351
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.57e-109
Family STAT DNA-binding domain 0.000000000299
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 9.02e-65
Family STAT 0.0000000141
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.97e-45
Family Transcription factor STAT-4 N-domain 0.0000181
Further Details:      
 
Domain Number 4 Region: 569-708
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-44
Family SH2 domain 0.000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010351   Gene: ENSBTAG00000007867   Transcript: ENSBTAT00000010351
Sequence length 747
Comment pep:known chromosome:UMD3.1:2:79888206:79927096:-1 gene:ENSBTAG00000007867 transcript:ENSBTAT00000010351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLESKYLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIICNCLKEERKILDHAQ
RISQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMSIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQLLLQKMYLMLDNKRKEVVLKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLALWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDN
LLPMSPEEFDEVSRMVGSVEFDMMNAV
Download sequence
Identical sequences B0JYL6 X2IZ01
XP_005903038.1.15283 ENSBTAP00000010351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]