SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010415 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010415
Domain Number 1 Region: 161-255
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-27
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010415   Gene: ENSBTAG00000007921   Transcript: ENSBTAT00000010415
Sequence length 280
Comment pep:known chromosome:UMD3.1:6:26167969:26224688:-1 gene:ENSBTAG00000007921 transcript:ENSBTAT00000010415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAESLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNERIGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLRDFVKHFANQPLIGSETG
TLIVLKHPYPKKVEEPSIYESVRVHTAMQTGRSENDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLDQGDGTVRSRSFIFQ
Download sequence
Identical sequences L8HP60 Q08DV4
ENSBTAP00000010415 9913.ENSBTAP00000010415 NP_001070359.1.59421 NP_001070359.1.76553 XP_005910366.1.15283 XP_019817957.1.53367 ENSBTAP00000010415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]