SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010444 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010444
Domain Number 1 Region: 8-219,327-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-51
Family FAD-linked reductases, N-terminal domain 0.0000622
Further Details:      
 
Domain Number 2 Region: 222-327
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.45e-25
Family D-aminoacid oxidase-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010444   Gene: ENSBTAG00000007946   Transcript: ENSBTAT00000010444
Sequence length 392
Comment pep:known chromosome:UMD3.1:19:20964785:20978420:1 gene:ENSBTAG00000007946 transcript:ENSBTAT00000010444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQRELYDAIVIGAGIQGCFTAYHLAKHSKKVLLLEQFFLPHSRGSSHGQSRIIRRAYP
EDFYTQMMAECYSLWAQLEHEAGTQLYRQTGLLLLGMKENPELKIIQATLSRQGVEHQCL
SSEELKQRFPNIRLARGEVGLLEVSGGVLYADKALRALQDAIRQLGGIVHDGEKVVEIKS
GLPVMVKTTSRSYQAKSLIITAGPWTNRLLRPLGAELPLQTLRINVCYWQEKVPGSYSVS
QAFPCFMGLGLSLAPHHIYGLPSREYPGLMKVCYHHGNNADPEERDCPAAFSDIQDVHIL
SGFVRDHLPDLQPEPAVMEHCMYTNTPDGHFVLDRHPKYDNIVIGAGFSGHGFKLSPVVG
KILYELSMKLTPSYDLTPFRISRFPSLGKAHL
Download sequence
Identical sequences Q29RU9
ENSBTAP00000010444 ENSBTAP00000010444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]