SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010461 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010461
Domain Number 1 Region: 572-710
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-45
Family Phosphotyrosine-binding domain (PTB) 0.0000157
Further Details:      
 
Domain Number 2 Region: 425-555
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-21
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010461   Gene: ENSBTAG00000007958   Transcript: ENSBTAT00000010461
Sequence length 716
Comment pep:known_by_projection chromosome:UMD3.1:19:41350972:41370441:-1 gene:ENSBTAG00000007958 transcript:ENSBTAT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVMSSPLLAGGPAVGLAPCEEPRRVLHPAPSPSLPPPCPYYTTEGWGAQALMAPMPCK
GPPGRLQPAPQAGANASCLLKAPGEQVSGAQEDLDSYIDFSLESLNQMILELDPTFQLLP
PGPGGPEAQPTQSTTLGKKKEEPEALDIKYIEVTSTRSRCHDGPRSCCSPSVTPPFGSPR
TGGLLLSRDLPRETRSSSESLIFSGSQGRGHQHPAPPSAVPSSHPPTSPSISIPGMGSKA
SGPHGLGSPLVASPSLEKGLGGQGPQLSSRVSMLSGSPASDISYVFGSSQSLLHSSISSH
QSSSRSLESPSSSSSSLNNLGPVSLYTRASDLQVPSNATPSMGQPRATRSPPLAKEHASS
CPPSITNSMTDIPIVLINGFPEPGSPPSQRTPGPQDFVRPGATSSSMPCPATRSHSQTLP
EAPPTASPEGPARDMQPTMKFVMDTSKYWFKPSISREQAIELLRKEEPGAFIVRDSSSYR
GSFGLALKVQEAPTPAQSRPGEDSSDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQ
HSIMALALPCKLVIPQKELGGGDGASDPSADGQASCLKKSAGCHALYLSSVSVETLSGAL
AVEKAISATLERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRRHYPLATLRFCGMDPEQR
KWQKYCKPSRIFGFVAKSQTESQENVCHLFAEYDTLQPASQVIRLVGALLQDPERM
Download sequence
Identical sequences F1MN94
9913.ENSBTAP00000010461 XP_005220792.1.76553 ENSBTAP00000010461 ENSBTAP00000010461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]