SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010556 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010556
Domain Number 1 Region: 264-459
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000478
Further Details:      
 
Domain Number 2 Region: 14-149
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-27
Family SH2 domain 0.000000348
Further Details:      
 
Domain Number 3 Region: 197-258
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010556   Gene: ENSBTAG00000008028   Transcript: ENSBTAT00000010556
Sequence length 459
Comment pep:known chromosome:UMD3.1:2:21880323:22081286:1 gene:ENSBTAG00000008028 transcript:ENSBTAT00000010556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTNEVENRPKYYGREFHGMISREAAD
QLLSVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDG
LITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAYQKHMPVLKETLDEKDSTGQDGVS
EKRLTSLVRRATLKENEQIPKYEKVHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCG
LNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKARTTKRPMVVDMCIREIEARGLNSE
GLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAY
PKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF
Download sequence
Identical sequences A7Z037
ENSBTAP00000010556 ENSBTAP00000010556 NP_001106718.1.59421 NP_001106718.1.76553 XP_005202376.1.76553 XP_005902604.1.15283 XP_005902605.1.15283 XP_005902606.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]