SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010675 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010675
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000863
Family YccV-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010675   Gene: ENSBTAG00000008116   Transcript: ENSBTAT00000010675
Sequence length 368
Comment pep:known chromosome:UMD3.1:19:20391106:20398885:-1 gene:ENSBTAG00000008116 transcript:ENSBTAT00000010675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVARRALTVGSRWWSRSLTGTRGPRPLCAAGGAGAFPPVATTTTRRHLSSRNRPEGK
VLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASAAPEKAENPAG
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHW
Download sequence
Identical sequences A5D9H9
ENSBTAP00000010675 ENSBTAP00000010675 NP_001091572.1.59421 NP_001091572.1.76553 XP_006042267.1.26621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]