SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010714 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010714
Domain Number 1 Region: 388-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.12e-34
Family Calponin-homology domain, CH-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 85-241,379-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.47e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.057
Further Details:      
 
Domain Number 3 Region: 723-754
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000774
Family LIM domain 0.0007
Further Details:      
 
Domain Number 4 Region: 690-722
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000493
Family LIM domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010714   Gene: ENSBTAG00000008147   Transcript: ENSBTAT00000010714
Sequence length 1070
Comment pep:known chromosome:UMD3.1:9:41186215:41197416:1 gene:ENSBTAG00000008147 transcript:ENSBTAT00000010714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTISTNPAHAHFESFLQAQLCQDVLSSFQGLCGALGVEPGGGLSQYHKVKAQLNYWNA
KSLWAKLDKRASQPVYQQGRACTGTKCLVVGAGPCGLRAAVELAMLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGSLDHISIRQLQLLLLKVALLLGVEIHWGIT
FTGLQPPPKKGSGWRAQLQPSPPAQLAKYEFDVLISAAGGKFVPEGFTVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLHKDWPDTERLLGSANVVPEALQRFARAAADFATHGKLGKLEFARDAHGRPD
VSAFDFTSMMRAESSARVQERHGTRLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAGPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPSQVR
DLYDMEAKEPVQRMSDETDSGKAATGAVGSQEELLRWCQEQTAGYPGVHVTDLSSSWADG
LALCALVHRLRPALLEPSELQGMGALEATSWALKMAEHELGITPVLSAQAMVAGSDPLGL
IAYLSHFHSAFKSVPHNPGSVSQGSPGTASAVLFLGKLQRTLQRTRTQENGEDAGGKKPR
LEVKAETPSTEEPPVPKPDEPMTPPSQQQDASAEDLCALCGQHLYILERLCADGRFFHRS
CFRCHICEATLWPGGYRQHPGDGYLYCLQHLPQTGHEEDSSDRGPESQDLPMSSENNTPS
GPATPVDLHQGTSPVPNPIQPTRRLIRLSSPERQRLSSLHLTPDPEMEPPPKPPRSCSTL
AHQALEASFKGWGMPVQSPQVLEAMEMGEEERSSSSEEETEEEEDVPLDSDMEHFLRNLA
ENSGTMNNYPTWRRTLLRRAKEEEMKRFCKAQAIQRRLNEIEAALRELEARGTELELALR
SQSSSPEKQKALWVEQLLQLVQKKNSLVAEEAELMITVQELNLEEKQWQLDQELRTYMNR
EETLKTAADRQAEDQVLRKLLDVVNQRDALIRLQEERRLSELASEPGVQG
Download sequence
Identical sequences F1MH07
ENSBTAP00000010714 XP_005210830.1.76553 XP_010806727.1.76553 ENSBTAP00000010714 9913.ENSBTAP00000010714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]