SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010796 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010796
Domain Number 1 Region: 466-542,588-648
Classification Level Classification E-value
Superfamily EF-hand 8.9e-25
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 220-286,328-388
Classification Level Classification E-value
Superfamily EF-hand 3.39e-19
Family EF-hand modules in multidomain proteins 0.00043
Further Details:      
 
Domain Number 3 Region: 1-57,109-178
Classification Level Classification E-value
Superfamily EF-hand 6.14e-19
Family Calmodulin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010796   Gene: ENSBTAG00000030189   Transcript: ENSBTAT00000010796
Sequence length 650
Comment pep:known_by_projection chromosome:UMD3.1:5:115352804:115419183:1 gene:ENSBTAG00000030189 transcript:ENSBTAT00000010796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIETDSEGNGILRRRDMKNALYGFDIPLTPREFEKLWMRYDSEGRGHITYQEFLQKLGIN
YSADIHRPYAEEYFNFMGHFTKPQQVQEELKELQQSTEKAMPARDKLKDHDQDISKALAK
LDKSRTGYISLGRLQRLLQECGCSLKEEELIDLLNRTSWGIAWHNNSINYLDFLRAVENN
KLTRPQSQEKEESVPINFAALSPEEVLKNIQGVIAASSLALSTAFSALDKEDTGFVKASD
FGQVLKDFCYKLTDNQYHYFLRKLRLHLTPYINWKYFLQNFSSYVEETAVEWAEKMPRGP
RPLSPKEMANQELLARLHKAVTSHYHAIAQEFENFDTMKTNTASRDEFRSICTRHVQVLT
DEQFDRLWEEMPVNSKGRLRYLDFLSSFNVDKQATPLATSDSAKAQRGSSVPEVSDRGRS
AGSSPTRDPKAGSKPRSHPCTQGGQTPSSVSGTPPLQNCEPIETKLRKKVQGCWRELLRE
CKERDFNKQGEIPGPEFLALVEKFNLDISRDECQQLLIKYDLKNNGKFAYCSFIQSCVLL
LKAKETSLMQRMKIQNANKMKEAGAETCSFYSALLRIQPKIVHCWRPMRRTFKAYDEGGT
GLLSVADFRKVLRQYSINLSEEEFFHILEYYDKTLSSKISYNDFLRAFLQ
Download sequence
Identical sequences G5E5A3
ENSBTAP00000010796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]