SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010816 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010816
Domain Number 1 Region: 64-312
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-79
Family Eukaryotic proteases 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010816   Gene: ENSBTAG00000031454   Transcript: ENSBTAT00000010816
Sequence length 337
Comment pep:known_by_projection chromosome:UMD3.1:22:53236358:53240657:1 gene:ENSBTAG00000031454 transcript:ENSBTAT00000010816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGGPHTLLVWLLLLQPWLTEASEDGSATSLPPPAPSGGDAKNRTVAQPPLRGASEVP
KLVEFSLACGQVFLKILGGHDSEEGKWPWQVSLRVRNRHVCGASLVTERWVLTAGHCILS
RYQYSVTMGDRKLQGTLSGLVVPVSRVVVHPQFSTSGTVKNDLALLRLRYPVNFTGVIQP
ICIPEKTFRVQAGTRCWVTGWGRKQEFGPLVSEVLQEIDQYIMYYEKCNGLLQMALRTDK
DLVQEGVICGYNSIGKDSCQGDSGGPLVCQYSTTWVQVGIVSWGVGCGRNNTPGVYTETA
LYAKWLVAVVNKAASLYPVVLLLLLCVVLPLGLLVTL
Download sequence
Identical sequences E1BI52
ENSBTAP00000010816 ENSBTAP00000010816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]