SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010838 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010838
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily EF-hand 8.41e-26
Family S100 proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010838   Gene: ENSBTAG00000008238   Transcript: ENSBTAT00000010838
Sequence length 101
Comment pep:known chromosome:UMD3.1:3:16967602:16971446:1 gene:ENSBTAG00000008238 transcript:ENSBTAT00000010838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSQLEQAITDLINLFHKYSGSDDTIEKEDLLRLMKDNFPNFLGACEKRGRDYLSNIFE
KQDKNKDRKIDFSEFLSLLADIATDYHNHSHGAQLCSGGNQ
Download sequence
Identical sequences Q28050
ENSBTAP00000010838 NP_777021.1.59421 NP_777021.1.76553 ENSBTAP00000010838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]