SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010913 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010913
Domain Number 1 Region: 320-614
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.07e-52
Family Glycerophosphoryl diester phosphodiesterase 0.0017
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.01e-21
Family Starch-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010913   Gene: ENSBTAG00000008293   Transcript: ENSBTAT00000010913
Sequence length 674
Comment pep:known_by_projection chromosome:UMD3.1:13:48086530:48150177:-1 gene:ENSBTAG00000008293 transcript:ENSBTAT00000010913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRMTPSQVTFEIRGTLLPGEVFAICGSCDALGNWNPQKAVALLPENETGESMLWKATIVL
SRGVSVQYRYFKGCFLEPKTIGGPCQVIVHKWETHLQPRSITPLESEIIIDDGQFGIHNG
IETLDSGWLTCQTEIRLRLHYSEKPPVSITKKKFKKSRFRVKLTLEGLEEDDDDRVSPTV
LHKMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDL
SEHVVQGDAFPGHVGTACLLSSTIAESGKSAGILTLPIMSRNSRKTIGKVRVDYIIIKPL
PGYSCDMKSSFSKYWKPRIPLDVGHRGAGNSTTTAQLAKVQENTIASLRNAASHGAAFVE
FDVHLSKDFVPVVYHDLTCCLTMKKKFDADPVELFEIPVKELTFDQLQLLKLTHVTALKS
KDLKESMVEEENSFSENQPFPSLKMVLESLPEDVGFNIEIKWICQQRDGMWDGNLSTYFD
MNLFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSDIYPELMDL
RSRTTPIAMSFAQFENLLGINAHTEDLLRNPSYIQEAKAKGLVIFCWGDDTNDPENRKKL
KEFGVNGLIYDRIYDWMPEQPNIFQVEQLERLKQELPELKSCLCPTVSRFVPSSLCGEPD
IHVDANGIDNVESA
Download sequence
Identical sequences E1BGB9
ENSBTAP00000010913 ENSBTAP00000010913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]