SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000010937 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000010937
Domain Number 1 Region: 285-452,531-701
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.26e-120
Family Mammalian PLC 0.00000115
Further Details:      
 
Domain Number 2 Region: 127-284
Classification Level Classification E-value
Superfamily EF-hand 5.02e-45
Family EF-hand modules in multidomain proteins 0.014
Further Details:      
 
Domain Number 3 Region: 719-835
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.56e-28
Family PLC-like (P variant) 0.0008
Further Details:      
 
Domain Number 4 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-25
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000010937   Gene: ENSBTAG00000008307   Transcript: ENSBTAT00000010937
Sequence length 1675
Comment pep:known_by_projection chromosome:UMD3.1:1:112962334:113071514:1 gene:ENSBTAG00000008307 transcript:ENSBTAT00000010937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERCMSVMQSGTQMIKLKRGTKGLVRLFYLDEHRTRLRWRPSRKSEKAKILIDSIYKVTE
GRQSEIFHRQAEGNFDPSCCFTIYHGNHMESLDLITSNPEEARTWITGLKYLMAGISDED
SLAKRQRTHDQWVKQTFEEADKNGDGLLNIEEIHQLMHKLNVNLPRRKVRQMFQEADTDE
NQGTLTFEEFCVFYKMMSLRRDLYLLLLSYSDKKDHLTVEELAQFLKVEQKMTNVTTDYC
IDIIRKFEVSEENKVKNVLGIEGFTNFMRSPACDIFNPLHHEVYQDMDQPLCNYYIASSH
NTYLTGDQLLSQSKVDMYARVLQEGCRCVEVDCWDGPDGQPVVHHGYTLTSKILFRDAAH
PINKHAFVKNEFPVILSIENHCSIQQQRKIAQYLKGIFQDKLDLSSIDTGETKQLPSPQS
LKGKILVKGKKLPYHLGDDAEEGEVSDEDSADEIEDECKFKLHYNNGTTEHQVESFIRKK
LESLLKESQIRDKEDPDSFTVRALLKATHEGLNAHLKQHPDAKESGKKAHGRSLMTNFGK
HKEKSASVKGMCYSVENLLRQRAGREGGGVFYRLGRRRKTMKLCRELSDLVVYTNSVAAQ
DIVDDGTTGNVLSFSETRAHQVVQQKSEQFMIYNQKQLTRIYPSAYRIDSSNFNPLPYWN
AGCQLVALNYQSEGRMMQLNRAKFKTNGNCGYVLKPQQMCKGTFNPFSGDPLPANPKKQL
ILKVISGQQLPKPPDSMFGDRGEIIDPFVEVEIIGLPVDCSKDQTRVVDDNGFNPVWEET
LTFTVHMPEIALVRFLVWDHDPIGRDFVGQRTVTFSSLVPGYRHVYLEGLTEASIFVHIT
INEIYGKWSPLILNPSYTILHFLGATKNRQLQGLKGLFNKNPRHNSSENTCHYIRKRSIG
DKILRRTASAPAKGRKKSKMGFQEMVEMKDSVSEAARDQDGVLRRTTRSLQARPVSMPVD
RSLLGALSLPVSETTKDTEGKENSQAEDKDARRDGKASVKDQHLPNFNKKLSSSSSALIH
KDISQGNSAVSTANLSITEQLVPGPKGGRTKSNMLSDCWEHQCLSRSLSPRQHLAHDPAV
SPSKDLCGVKTKENGNAGGFVVGKSTLSGSILSQSNLEIKKLEGNWDKGRAATSFSLSDV
STLCSDAPDLHSTAILQESEISHLIDNVTLTNENEPGSSISALIGQFDETGNQANPTVVS
HLQSPSVMSGHPPVPTMDLKMPFKPGFSNGKPKSSFLCSSPEQIALSGHETCECSTHTAV
GETMCTPVSKMKPDNDLSGKAMTGAIENNLPQSSNTSHCWLPESPTHGKDWEILKNPSPA
TSTDLTLEDVIAAPTLSLNSGESSLVEMDGDSENLSLTTYEYRREGTSHLTSPLKVKYSP
AAVEHFQRGLRNGYCKETLHPSVSEIFNNTQDVKNQNISHLAYQGAGFMHNHFSNSDAKT
NQTSGPLPCAHDLHAPAPEQSTHSALKLSSPCKSKSLGDLTSEDIACNFESKYQCISKSF
VTTGIRDKKGMTVKTKSLEPMDALTEQLRKLVSFDQEDGCQVLYSKQDANQFPRALVRKL
SSRSQSRVRNIASRAKEKQEANRQKSVNPSTVGGVVLRSKPCAPAPTGNRHSTGSYIAGY
LRSAKGGSLEGRGIPEGACAALRSGHVDRFCSHHSVLQTEPSSDDKPEIYFLLRL
Download sequence
Identical sequences F1MF11
ENSBTAP00000010937 9913.ENSBTAP00000010937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]