SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011047 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011047
Domain Number 1 Region: 50-197
Classification Level Classification E-value
Superfamily EF-hand 9.62e-35
Family SCOPe 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011047   Gene: ENSBTAG00000008394   Transcript: ENSBTAT00000011047
Sequence length 199
Comment pep:known chromosome:UMD3.1:22:53202766:53208551:1 gene:ENSBTAG00000008394 transcript:ENSBTAT00000011047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKPDPKKDEAKAGAKAAAAPAPAPAPPPAPEPSKEPEFDPSKIKIEFTPEQIEEFKE
AFTLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLP
MLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKLTEDEVEKLMAGQ
EDSNGCINYEAFVKHIMAG
Download sequence
Identical sequences L8HPT1 P85100
ENSBTAP00000011047 9913.ENSBTAP00000011047 ENSBTAP00000011047 NP_001069969.2.59421 NP_001069969.2.76553 5n69_G 5n69_H 6fsa_D 6fsa_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]