SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011077 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011077
Domain Number 1 Region: 561-916
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.61e-110
Family PDEase 0.00000226
Further Details:      
 
Domain Number 2 Region: 373-556
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-49
Family GAF domain 0.0000000656
Further Details:      
 
Domain Number 3 Region: 204-387
Classification Level Classification E-value
Superfamily GAF domain-like 1.96e-36
Family GAF domain 0.0000000171
Further Details:      
 
Domain Number 4 Region: 25-178
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000706
Family GAF domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011077   Gene: ENSBTAG00000008419   Transcript: ENSBTAT00000011077
Sequence length 921
Comment pep:known chromosome:UMD3.1:15:52913333:52984107:-1 gene:ENSBTAG00000008419 transcript:ENSBTAT00000011077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRQPAASRDLFAQEPVPPGSGDGALQDALLSLGSVIDVAGLQQAVKEALSAVLPKVETV
YTYLLDGESRLVCEEPPHELPQEGKVREAVISRKRLGCNGLGPSDLPGKPLARLVAPLAP
DTQVLVIPLVDKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALKRVQALQQRESSV
APEATQNPPEEAAGDQKGGVAYTDQDRKILQLCGELYDLDASSLQLKVLQYLQQETQASR
CCLLLVSEDNLQLSCKVIGDKVLEEEISFPLTTGRLGQVVEDKKSIQLKDLTSEDMQQLQ
SMLGCEVQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDEHVIQHCFHYTSTVLTST
LAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQNEL
VAKVFDGGVVEDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTR
NILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEA
QYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAIL
SMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNY
LEDMEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNT
HGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRTNKQHHSLLL
CLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQI
SFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEY
EVPDLDGARAPINGCCSLDAE
Download sequence
Identical sequences F1N0Y8
ENSBTAP00000011077 ENSBTAP00000011077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]