SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011204 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011204
Domain Number 1 Region: 11-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-84
Family Eukaryotic proteases 0.0000000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011204   Gene: ENSBTAG00000008500   Transcript: ENSBTAT00000011204
Sequence length 263
Comment pep:known chromosome:UMD3.1:18:2590736:2595390:-1 gene:ENSBTAG00000008500 transcript:ENSBTAT00000011204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLWLLSCFALVGAAFGCGVPAIQPVLSGLARIVNGEDAVPGSWPWQVSLQDSTGFHFC
GGSLISEDWVVTAAHCGVTTSDVVVAGEFDQGLQTEDTQVLKIGKVFKNPKFSILTVRND
ITLLKLATPAQFSETVSAVCLPSADEDFPAGMLCATTGWGKTKYNALKTPDKLQQATLPI
VSNTDCRKYWGSRVTDVMICAGASGVSSCMGDSGGPLVCQKNGAWTLAGIVSWGSSTCST
STPAVYARVTALMPWVQETLAAN
Download sequence
Identical sequences A7YWU6
NP_001098800.1.59421 NP_001098800.1.76553 XP_019834088.1.53367 ENSBTAP00000011204 ENSBTAP00000011204 9913.ENSBTAP00000011204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]