SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011251 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011251
Domain Number 1 Region: 386-507
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-24
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 2 Region: 511-550
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000102
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011251   Gene: ENSBTAG00000008535   Transcript: ENSBTAT00000011251
Sequence length 578
Comment pep:known_by_projection chromosome:UMD3.1:19:39648073:39672758:1 gene:ENSBTAG00000008535 transcript:ENSBTAT00000011251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFRNVGRPPEEEDAEAAQEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGLEAQL
AALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLVLEGL
ESEAESLETNSCSEEELSSPGRGGGGGGRLLLQTPGPELPPVPFPMQDLVPPGRLSRGEQ
PQQPPPPPPPPGPLRPLAGLSRKGSLKIRLSRLFRTKSCNGGSGGGDGAGKRPSGELVAS
AASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTSPH
PPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAFPRIAPIRA
AESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLV
RDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKN
GKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPL
ISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVLEPST
Download sequence
Identical sequences E1BIS1
ENSBTAP00000011251 ENSBTAP00000011251 9913.ENSBTAP00000011251 NP_001192942.1.59421 NP_001192942.1.76553 XP_005220664.2.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]