SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011457 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011457
Domain Number 1 Region: 15-194
Classification Level Classification E-value
Superfamily EF-hand 3.8e-35
Family Calmodulin-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011457   Gene: ENSBTAG00000008693   Transcript: ENSBTAT00000011457
Sequence length 212
Comment pep:known chromosome:UMD3.1:14:21456452:21464699:-1 gene:ENSBTAG00000008693 transcript:ENSBTAT00000011457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKKLQKLTDSLTKNCKHFSKFEVKCLINLFYNLVGEVTERQGVIIGLDRNAFRNILHM
TFGMTDDMIMDRVFRGFDKDNDGCISVTEWVYGLSVFLRGTLEEKMKYCFEVFDLNGDSF
ISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYEQAVREETL
LLEAFGPCLPDPKSQSEFEAQVFKDPNEFNEV
Download sequence
Identical sequences Q32L26
ENSBTAP00000011457 NP_001032674.1.59421 NP_001032674.1.76553 XP_005892046.1.15283 XP_010837243.1.44457 XP_014332548.1.15283 XP_019829643.1.53367 XP_019829645.1.53367 ENSBTAP00000011457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]