SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011496 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011496
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily EF-hand 3.68e-43
Family Calmodulin-like 0.0000000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011496   Gene: ENSBTAG00000008726   Transcript: ENSBTAT00000011496
Sequence length 160
Comment pep:known_by_projection chromosome:UMD3.1:11:100548300:100564121:1 gene:ENSBTAG00000008726 transcript:ENSBTAT00000011496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALS
VTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD
RIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091H5H0 D2H171 F1MZQ0 F1PET6 F6WGJ6 G1N134 G9KCV0 H0XKR7 L5K7C3
ENSPVAP00000003345 ENSBTAP00000011496 ENSCAFP00000029561 ENSOGAP00000016707 ENSPVAP00000003345 ENSBTAP00000011496 ENSSSCP00000006105 9615.ENSCAFP00000029561 9823.ENSSSCP00000006103 9823.ENSSSCP00000006105 ENSMGAP00000005178 ENSMGAP00000005178 ENSCJAP00000037900 ENSSSCP00000006105 XP_010135997.1.100080 ENSCAFP00000029561 ENSOGAP00000016707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]