SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011633 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011633
Domain Number 1 Region: 44-185
Classification Level Classification E-value
Superfamily Lipocalins 2.12e-19
Family Retinol binding protein-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011633   Gene: ENSBTAG00000008833   Transcript: ENSBTAT00000011633
Sequence length 188
Comment pep:known chromosome:UMD3.1:23:27459277:27461382:-1 gene:ENSBTAG00000008833 transcript:ENSBTAT00000011633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHHIWAALLYLCGILLNSIYQCPEHSQLTTEGVDGKEFPEPHLGQWYFIAGAAPTKEEL
ATFDPVDNIVFNMAVGSAPMQLQLRATIRTKNGLCVPRKWIYHLSDGSTDLRTEGRPDMK
TKLFSSACPGGIMLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLLTPRNQ
DACELSSN
Download sequence
Identical sequences F1MYX2 L8I4K2
ENSBTAP00000011633 9913.ENSBTAP00000011633 ENSBTAP00000011633 NP_001029429.2.59421 NP_001029429.2.76553 XP_005904246.1.15283 XP_010816617.1.76553 XP_019841013.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]