SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011676 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011676
Domain Number 1 Region: 34-380
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.73e-136
Family Calpain large subunit, catalytic domain (domain II) 0.000000000126
Further Details:      
 
Domain Number 2 Region: 385-544
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.66e-54
Family Calpain large subunit, middle domain (domain III) 0.00000151
Further Details:      
 
Domain Number 3 Region: 561-730
Classification Level Classification E-value
Superfamily EF-hand 3.9e-47
Family Penta-EF-hand proteins 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011676   Gene: ENSBTAG00000003600   Transcript: ENSBTAT00000011676
Sequence length 732
Comment pep:known chromosome:UMD3.1:16:27679426:27748095:-1 gene:ENSBTAG00000003600 transcript:ENSBTAT00000011676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGPGRFPASKLSAERQKGRAVYPTEPSAMAALAARVTRQRAATEGLGSSQKAVRYLGQD
FETLRQQCLDSGLLFKDPEFPACPSALGYKDLGPCSPRTQGVVWKRPMELCPSPQFIVGG
ATRTDICQGALGDCWLLAAIASLTLNRELLYRVVPRDQSFQENYAGIFRFQFWQYGEWVE
VVVDDRLPTKNGKLLFLHSEEGSEFWSALLEKAYAKLNGSYEALTGGSTVEGFEDFTGGI
SEFYNLKKPPASLFQIIQKALRSGSLLACSIDISSAAETEAITSQKLVKGHAYSVTGVEE
VDFRGCPERLIRLRNPWGEVEWKGAWSDDAPEWNYIDPRQKEQLGKKAEDGEFWMSFSDF
LRQFSRLEICNLSLDSLSSEEAHKWSLVLFNGRWTRGSTAGGCQNYPATYWTNPQFKIHL
DEVDDHQEEGVSEPCCTVLLGLMQKNRRRQKRMGQGMLSIGYAVYKIPKELESHTDAHLG
RDFFLGRPPAARSSTYVNLREVSARVQLPPGEYVVVPATFEPFQDGDFCLRVFSEKKAKA
LEIGDVVVGNPHEPRPSEVEQEDGQLRSLFEKFAGKDSEIRANELRTALNEVFSKRTDIK
FDGFDINTCREMISLMDSNGTGSLELVEFKTLWLKIRKYLDIFRETDHNHSGTIDAHEMR
TALKKAGFTLSDQVQQTIAMRYACSKLTMDFDSFIACMIRLETLFKLFRLLDKDQNGIVQ
LSLAEWLCCVLV
Download sequence
Identical sequences E1BKJ3
ENSBTAP00000011676 ENSBTAP00000016982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]