SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011677 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011677
Domain Number 1 Region: 46-273,323-426
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-131
Family Calpain large subunit, catalytic domain (domain II) 0.00000000524
Further Details:      
 
Domain Number 2 Region: 430-581
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.4e-57
Family Calpain large subunit, middle domain (domain III) 0.00000166
Further Details:      
 
Domain Number 3 Region: 638-821
Classification Level Classification E-value
Superfamily EF-hand 1.25e-51
Family Penta-EF-hand proteins 0.00000453
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011677   Gene: ENSBTAG00000008868   Transcript: ENSBTAT00000011677
Sequence length 822
Comment pep:known chromosome:UMD3.1:10:37828797:37885860:1 gene:ENSBTAG00000008868 transcript:ENSBTAT00000011677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVISASVAPRTGAEPMSPGPIAQAAQDKGTEAGGGNPSGIYSAIISRNFPIIGVKEKT
FEQLHKKCLEKKVLFVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIVGGANRTD
ICQGDLGDCWFLAAIACLTLNKRLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFE
IKDAPRDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLKMGELIERMVRNMDNSRLR
DSDLIPEGCSDDRPTRMIVPVQFETRMACGLVKGHAYSVTGLEEALYKGEKVKLVRLRNP
WGQVEWNGSWSDSWKDWSYVDKDEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTAD
ALESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICS
FLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSRTYIN
MREVSERFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKN
KPIIFVSDRANSNKELGVDQETEEGKDNTSPDKQAKSPQLEPGNTDQESEEQRQFRNIFR
QIAGDDMEICADELKNVLNRVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHH
LWKKIKTWQKIFKHYDTDQSGTINSYEMRNAVKDAGFHLNNQLYDIITMRYADKYMNIDF
DSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences A6QP82
ENSBTAP00000011677 9913.ENSBTAP00000011677 XP_019824157.1.53367 ENSBTAP00000011677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]