SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011680 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011680
Domain Number 1 Region: 9-357
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.84e-134
Family Calpain large subunit, catalytic domain (domain II) 0.00000000576
Further Details:      
 
Domain Number 2 Region: 361-512
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.62e-57
Family Calpain large subunit, middle domain (domain III) 0.00000166
Further Details:      
 
Domain Number 3 Region: 531-707
Classification Level Classification E-value
Superfamily EF-hand 1.31e-51
Family Penta-EF-hand proteins 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011680   Gene: ENSBTAG00000008868   Transcript: ENSBTAT00000011680
Sequence length 709
Comment pep:known chromosome:UMD3.1:10:37842235:37885860:1 gene:ENSBTAG00000008868 transcript:ENSBTAT00000011680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYLLPGFFCDRVIRERDRRNGEGTATQPIKYEGQDFVVLRQRCLAQKCLFEDRVFPAGI
QSLGSHELSQKTKMKAIAWKRPKEICENPRFIVGGANRTDICQGDLGDCWFLAAIACLTL
NKRLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEF
WSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEIKDAPRDMYKIMKKAIERGS
LMGCSIDMIVPVQFETRMACGLVKGHAYSVTGLEEALYKGEKVKLVRLRNPWGQVEWNGS
WSDSWKDWSYVDKDEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTADALESDKLQT
WTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKN
RRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSRTYINMREVSERFR
LPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVLEPGNTDQESEEQR
QFRNIFRQIAGDDMEICADELKNVLNRVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRL
NLQEFHHLWKKIKTWQKIFKHYDTDQSGTINSYEMRNAVKDAGFHLNNQLYDIITMRYAD
KYMNIDFDSFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA
Download sequence
Identical sequences F1MYC8
ENSBTAP00000011680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]