SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011687 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011687
Domain Number 1 Region: 21-165
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000174
Family S100 proteins 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011687   Gene: ENSBTAG00000008876   Transcript: ENSBTAT00000011687
Sequence length 215
Comment pep:known_by_projection chromosome:UMD3.1:20:3892867:3898661:1 gene:ENSBTAG00000008876 transcript:ENSBTAT00000011687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKQGSFLWYLYLDKLYCLLSVRNVKALVEYFHLLDVHHKKTLNDVLFYHFLHHVTDLT
RNQITVVFNMLDWNAVGEIGFDQFYMLVCILLAQENHLEEQFIFRHSRPVFELLDLDGEL
KIGPDHLHMYNFLFNIKKQQLRDLYYNFDITGDRKLLNYKEFKLFTIFSMDKYQESQKAE
KEKKKEKAVLKKKLSQHVPVLLLLFRPILSTRSLC
Download sequence
Identical sequences E1BKI7
ENSBTAP00000011687 9913.ENSBTAP00000011687 ENSBTAP00000011687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]