SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011696 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011696
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.43e-51
Family Calponin-homology domain, CH-domain 0.00000035
Further Details:      
 
Domain Number 2 Region: 186-248
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.59e-22
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011696   Gene: ENSBTAG00000008884   Transcript: ENSBTAT00000011696
Sequence length 266
Comment pep:known chromosome:UMD3.1:11:72598140:72653468:-1 gene:ENSBTAG00000008884 transcript:ENSBTAT00000011696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRK
VKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYD
GKDYNPLLARQGQDVAPPPNPVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGG
HETDAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGIL
YATEEGFAPPEDDEIEEHQQEDQDEY
Download sequence
Identical sequences Q0VC55
ENSBTAP00000011696 ENSBTAP00000011696 ENSFCAP00000019593 NP_001069385.1.59421 NP_001069385.1.76553 XP_004005792.1.66739 XP_004268170.1.21590 XP_004394949.1.74151 XP_004418307.1.5094 XP_005630292.1.84170 XP_005630293.1.84170 XP_005895770.1.15283 XP_005978984.1.78601 XP_007108473.1.24612 XP_007191363.1.59432 XP_010838907.1.44457 XP_011233293.1.58354 XP_012013627.1.54773 XP_012507929.1.63892 XP_012643656.1.48125 XP_012643657.1.48125 XP_012659216.1.62490 XP_012918435.1.14098 XP_013212870.1.77405 XP_014448616.1.99106 XP_014705811.1.49734 XP_014919616.1.86478 XP_015335375.1.40921 XP_017506204.1.32401 XP_017911018.1.57651 XP_019305254.1.44245 XP_019683344.1.62641 XP_019826129.1.53367 XP_020034328.1.5219 XP_020741976.1.74333 XP_021553078.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]