SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011718 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011718
Domain Number 1 Region: 20-263
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.45e-78
Family Eukaryotic proteases 0.0000000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011718   Gene: ENSBTAG00000008900   Transcript: ENSBTAT00000011718
Sequence length 266
Comment pep:known chromosome:UMD3.1:5:28622128:28637016:1 gene:ENSBTAG00000008900 transcript:ENSBTAT00000011718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLLVFTSLVLYGHSTQDFPETNARVVGGTAVSKNSWPSQISLQYKSGSSWYHTCGGTL
IKQKWVMTAAHCVDSQMTFRVVLGDHNLSQNDGTEQYISVQKIVVHPSWNSNNVAAGYDI
AVLRLAQSATLNSYVQLGVLPQSGTILANNTPCYITGWGRTKTNGQLAQTLQQAYLPSVD
YATCSSSSYWGSTVKTTMVCAGGDGVRAGCQGDSGGPLHCLVNGQYAVHGVTSFVSSLGC
NVSKKPTVFTRVSAYISWINNAIASN
Download sequence
Identical sequences Q28153
ENSBTAP00000011718 ENSBTAP00000011718 9913.ENSBTAP00000011718 NP_776473.1.59421 NP_776473.1.76553 XP_005206313.1.76553 XP_019816097.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]