SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011737 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011737
Domain Number 1 Region: 23-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.75e-68
Family Eukaryotic proteases 0.000000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011737   Gene: ENSBTAG00000027033   Transcript: ENSBTAT00000011737
Sequence length 260
Comment pep:novel chromosome:UMD3.1:21:35112322:35115054:-1 gene:ENSBTAG00000027033 transcript:ENSBTAT00000011737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEAARALGSLSEKMHHPPLPLLLLLLLCCRTQAGEIIGGTESKPHSRPYMAYLQIVTWHG
KLAACGGFLIRRDFVLTAAHCAGRSITVILGAHNLQKKEDTWQRLEVIKQFPYPKYEHVG
LHDIMLLKLKEKANLTLAVGTIPLPSHFTFIHPGIMCWVAGWGQTAVNEPASSILQEVEL
RLMEPRACSHFSAFNHNLQLCVGNPQSTKSTFKGDSGGPLLCAGVAQGIVSYGLSNAKPP
AVFTRISPYRPWIDEVLKGN
Download sequence
Identical sequences E1BIP7
ENSBTAP00000011737 ENSBTAP00000011737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]