SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011856 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011856
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-38
Family Dual specificity phosphatase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011856   Gene: ENSBTAG00000009005   Transcript: ENSBTAT00000011856
Sequence length 235
Comment pep:known_by_projection chromosome:UMD3.1:13:61941884:61950327:-1 gene:ENSBTAG00000009005 transcript:ENSBTAT00000011856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGMTKVLPGLYLGNFIDAKDTDQLGRNKITHIISIHESPQPLLQDITYLRISVADAPE
VPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLSWRDVLEAIKA
TRPIANPNPGFRQQLEEFGWGSSRKLRRQLEERFGESPFRDEEEVRALLPLCKRCRQGSA
TAAASPAPNSTASEGTLQRLVPRSPREAHRPLPLLARVKQTFSCLPRCLSRKGSK
Download sequence
Identical sequences E1BG89
ENSBTAP00000011856 ENSBTAP00000011856 XP_002692331.1.76553 XP_875835.3.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]