SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000011888 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000011888
Domain Number 1 Region: 8-92,128-193
Classification Level Classification E-value
Superfamily EF-hand 2e-26
Family Calmodulin-like 0.0029
Further Details:      
 
Domain Number 2 Region: 434-515,553-563
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.49e-18
Family Ferredoxin reductase FAD-binding domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 569-754
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.00000000000474
Family Flavohemoglobin, C-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000011888   Gene: ENSBTAG00000009030   Transcript: ENSBTAT00000011888
Sequence length 755
Comment pep:known chromosome:UMD3.1:10:15835507:15867515:1 gene:ENSBTAG00000009030 transcript:ENSBTAT00000011888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAEEDAKWLQWVTHQFKTIAGEDGEINLQDFKKALKVKESFFAERFFVLFDSDGSGTIT
LQELQKALTLLIHGSPMDKLKFLFQVYDVDGKHPLWDGRRTQREGQRERPVSVTAQHWAS
SSPETGSGSIDADELRTVLQSCLYESAISLPKEKLDQLTLALFESADKDCSGTITFEELR
DELQRFPGVLENLTISAAHWLTPPAPQRHRRQPRLLTSAYWHNHRSHVLCLAVFVGLHML
LFALAASAYRAFGSSVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATWLAQVLPLDHNI
QFHQLMGYVVVGLSLVHTVAHVVNFALQAQSETSPFRFWELLLTTRPGIGWVHGSASPTG
VALLLLLLLMFACSSSCVRRSGHFEVFYWTHLSYLPMWLLLILHGPNFWKWLLVPGTLFF
LEKTISLAASRMAALHIVEVNLLPSKVTHLLIKRPPLFHYRPGDYLYLNIPSIARYEWHP
FTISSAPEQKDTIWLHIRSQGQWTNRLFESFKKPEPVFCGSKRLSRRLEMKRSQRKPQVS
EMSSENHQFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASILQSILYRHQKRK
HICPNCQHSWMESGQDEDMKLHKVDFIWINRDQQSFEWFVSLLTKLEMDQAEETQVGRFL
ELHMYMTSALSKNDIKAIGLQMALDLLAKKEKKDSITGLQTRTQPGRPDWNKVFQKVAAE
KKGKVQVFFCGSPALAKILKGHCEQFSFKFFQENF
Download sequence
Identical sequences A7E3L4
NP_001094607.1.59421 NP_001094607.1.76553 ENSBTAP00000011888 9913.ENSBTAP00000011888 ENSBTAP00000011888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]