SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012345 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012345
Domain Number 1 Region: 402-511
Classification Level Classification E-value
Superfamily SH2 domain 8.35e-22
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000523
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012345   Gene: ENSBTAG00000009381   Transcript: ENSBTAT00000012345
Sequence length 532
Comment pep:known_by_projection chromosome:UMD3.1:20:2032973:2082267:-1 gene:ENSBTAG00000009381 transcript:ENSBTAT00000012345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFKNVPFRSEVLSWDPNTLADYFKKLNYKDCEKVVRKYDIDGPRFLNLAENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVQRFPEETESHEEDNGGWSSFEEDDYESPNDDA
DAEDDGDYESPNEEEEAPLEDDADYEPPPSNDEEALQNSILPAKPLSNPNSMYIDRPATG
KVQQPPVPPQRPMPSLPPLPTAGRIHQPLPPPQPNHEEPSRSRNHKTAKLPAPSIDRSTK
PALDRSLVPFDREPFTLGWKPMISDKSSVLGGRPPGEHLPKIQKPPLPPATERHDRGSPL
PGKKPPVPRHMRGPERRENDEDDVHQRLPPQPSPLPMTSNTFPSRSTKPSPKNSLPLTHS
SGAFSESNSNFSQSASLPPYFSQGPGNRPLPRMEGRNFSPVPSKPRSQSPGEEENSLNED
WYVSYVTRTEAEAALRKINQDGTFLVRDSSKKTISNPYVLMVLYKDKVYNIQIRYQEESQ
VYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTYSAGYP
Download sequence
Identical sequences F1MGR6
ENSBTAP00000012345 ENSBTAP00000012345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]