SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012479 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012479
Domain Number 1 Region: 189-269,320-385
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000377
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012479   Gene: ENSBTAG00000009481   Transcript: ENSBTAT00000012479
Sequence length 547
Comment pep:known_by_projection chromosome:UMD3.1:3:86260319:86342617:1 gene:ENSBTAG00000009481 transcript:ENSBTAT00000012479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVWKTPRGSNAMPEMMVKIIGSKHFRYLVEKPKIKENQNLKAETQTVLQKSVTGDAKP
IGGDPPALTDPTDHQINHDPDDVKESKHQENNQKPEDNGKLLTGALSCRFLDGKVSNQAN
VYCISQPTGDQSLSYIHGLPRRNFRDWSLEQMARSSSDQPKDIGQRPSGTKKEDTFLLAL
VRRELKSLPLSSGLLDKLQKELKVLDPVSSGFLLQSQLSHLFLRLEVPLQLPTVKILCQR
FSRGSSPEMVNYEKLLWFLKVAASEDTEQNKGVEDSNVKETQSSSHQSSIAPQDYNSQSE
VNESLLEVLKMALRATKAKLNIEKLNLSFRKEDRSFSGCLPPPKVRAICGKHGLYLTLSL
LETLLNHQDLGYQNEIKWENFVEWLGRASSDLSSDFPPGNKGKEISATPGHPEGPEISQG
ETEQMKTPEKDLKPENPPAETSAPKDILNALKIRPISQPSVSPVMKNAAEECETWIDRFR
KLENALYLCDLSNTGVLEKERARRLIHNYNLIYNLSLSPRKIDQALRSFCAGENMLLEPA
LRYLKEL
Download sequence
Identical sequences E1BCG0
ENSBTAP00000012479 ENSBTAP00000012479 XP_015320728.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]