SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000012497 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000012497
Domain Number 1 Region: 327-584
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.66e-99
Family STAT DNA-binding domain 0.0000593
Further Details:      
 
Domain Number 2 Region: 136-332
Classification Level Classification E-value
Superfamily STAT 1.39e-54
Family STAT 0.00017
Further Details:      
 
Domain Number 3 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 9.55e-39
Family Transcription factor STAT-4 N-domain 0.00044
Further Details:      
 
Domain Number 4 Region: 585-707
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-34
Family SH2 domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000012497   Gene: ENSBTAG00000010125   Transcript: ENSBTAT00000012497
Sequence length 787
Comment pep:known chromosome:UMD3.1:19:42960226:42996671:-1 gene:ENSBTAG00000010125 transcript:ENSBTAT00000012497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIEGQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFVSASADSAG
GSATYMDQAPSPAVCPQPHYNMYPQNPDPVLDNDGDFDLDDTIDVARRVEELLGRPMDSQ
WIPHAQS
Download sequence
Identical sequences A0A140T878
9913.ENSBTAP00000012497 ENSBTAP00000012497 NP_777042.2.59421 NP_777042.2.76553 XP_005220730.1.76553 XP_005220731.1.76553 ENSBTAP00000012497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]